PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.B03670.1.p
Common NameEUGRSUZ_B03670, LOC104433825
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family FAR1
Protein Properties Length: 736aa    MW: 85189.5 Da    PI: 6.8148
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.B03670.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR184.71.5e-2629114291
              FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                       fY+eYA+ +GF + k +s++s+ ++e+++++f C ++g++++++++     ++r++ ++gCka+++vk+++dgkw v+++++eHnHel p
  Eucgr.B03670.1.p  29 FYKEYARAAGFGTAKLSSRRSRASKEFIDAKFSCIRYGNKQQSDDA----INPRPSPKIGCKASMHVKRRQDGKWFVYSFVKEHNHELLP 114
                       9***************************************999877....9************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031014.3E-2429114IPR004330FAR1 DNA binding domain
PfamPF105515.7E-28227319IPR018289MULE transposase domain
PROSITE profilePS5096610.497507543IPR007527Zinc finger, SWIM-type
PfamPF044341.5E-7511541IPR007527Zinc finger, SWIM-type
SMARTSM005751.5E-6518545IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 736 aa     Download sequence    Send to blast
MEPDKVTANA IAEPRDDMEF ESHEDAYAFY KEYARAAGFG TAKLSSRRSR ASKEFIDAKF  60
SCIRYGNKQQ SDDAINPRPS PKIGCKASMH VKRRQDGKWF VYSFVKEHNH ELLPAQVHFF  120
RSHRDADLVK NDVRLRKRKN LSSMSKMFSS YQNLDNLDNY LRNPHDKGRS LVLEAGDAQL  180
LLEFFMHMQE QNPKFFYAID LNEEHRLRNV FWVDAKGIED YSKFGDVVSF DTTYFANKYK  240
MPLVLFTGVN HHGQPTLFGS ALIADDTVYT FAWLMQTWLV AMGEQAPQVI LTDQNNAIKL  300
ATAAIFPHTR HFFCLWHILD RIPRELEYLG VWQDTIVAKF NKCIFGSWSE AEFDKRWWKL  360
LDRFNLREVE WVQLLYQDRM QWAPTFMRDI SFAGLSAFSR AESLNSWFDK YVNGETSLRE  420
FIEKYKVILE DRYEEEAKAD FDAWHEAPEL KSPSPFEKQM SLVYTHEIFR KFQIEVLGAA  480
ACHLKKESED ERATIYAVKE FEDDRNYVVE WNESKSSIYC SCHSFEYKGY LCRHAMIVLQ  540
MSGVFSIPSR YILQRWTNAA LSRHPIGEKS EDMQSKVRRY NDLCRRAIIL GEEGSLSQES  600
YDIALCAIMA ALKQCSSVNT PAENEARPNN STVHATCNAE EENQCSTSKE QVPDPKVSNR  660
SKNTSRKGKV TEPDLLGAMA QDGLHQMEVP QVRTTHLHGM VPMQLHNLVP TMFHNVPPTP  720
FQNVASMQLH DNHLP*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.B03670.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010045003.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 4
RefseqXP_010045002.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 4
RefseqXP_010045001.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 4
SwissprotQ6NQJ70.0FRS4_ARATH; Protein FAR1-RELATED SEQUENCE 4
TrEMBLA0A059D8S10.0A0A059D8S1_EUCGR; Uncharacterized protein
STRINGVIT_09s0054g01830.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM11826253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76320.10.0FAR1-related sequence 4